COSMOS: A Spacetime Odyssey

Part II: The Gods

One of the really cool things about working on this project was that they were VERY interested in getting all the facts right when it came to historical depictions and they had a dedicated research team that would provide me with all of the most accurate information they could find for every scene in the mini-doc. It was incredibly helpful for illustrating things like the ancient farming techniques, and also for this sequence which featured distinct gods from 6 different civilizations. There was still a little bit of creative interpretation on my end, especially for some of the more obscure gods, but luckily it was close enough and I got the OK from the research team!

1,934 notesSERIAL NO. 863165237703 months ago
  1. fizzule reblogged this from kevindart
  2. eloquentboobs reblogged this from kevindart
  3. indiepretties reblogged this from implodingoracle
  4. justfuckingnougat reblogged this from duergarglaive
  5. duergarglaive reblogged this from kevindart
  6. thekingwithdogears reblogged this from kevindart
  7. ray-of-fusshion reblogged this from milliemunchers
  8. koolarty reblogged this from animationtidbits
  9. j42smith reblogged this from kevindart
  10. sparklygoggles reblogged this from kevindart
  11. paperaloves reblogged this from udee
  12. tom-de-fun reblogged this from kevindart
  13. artsyblackkid reblogged this from kevindart
  14. visualartendeavour reblogged this from kevindart
  15. udee reblogged this from kevindart
  16. ancientforesttemple reblogged this from kevindart
  17. kosmikoff reblogged this from kevindart
  18. swoobatpng reblogged this from kevindart
  19. helianthus reblogged this from fistfulofstars

Please wait one minute. 




natazillamsmollymcliobabliopug-of-warulan-batorshinypinkbottlejunyiwutheimportanceofbeingmodernistcrowdedteethobscurevideogamescharleshuettnerianjqoktotallyagredamodelarchitecturerebeccasugarkingofoooprobertsonerinkkavanaghtoffanybabsbabsbabswolfhardbeatonnavictoriayingthreewordphraseempartridgeemilywalusalex-rimbaultturnislefthomethedavidoreillykikutowneavclubbeckyandfrankfabien-menselecrcrsbosmarebeccamockgunshowcomickeepbeachcityweirdneo-ramanatgeofoundjeffturleybombsfallstefsketchessvffsketchsharktrevorstreasuretrovestevencrewniversescottlavaseokimdannyhynescardurrmattforsythecolormathjeremykukalidrawskiuchitatsurophilnotoyvanduqueluisgranejoeyarthjmichellefemfreqverganisophiafosterdiminojonklassen2dadushintroffienedroidcomicstimothylambdarrickbachmanguyyanaiseventypercentethanolalexxgriggkatiejricegreaterthanorequaltoemmanuellewalkerpenguin-boyjeremieperinanthonyvivienaceveefenrykpaperalligatortombunkertextastropheellemichalkamooer-dartanimationarchiveheejindrawspappapamplemoussecartoonretroeastwoodwongmorenohugowaltermartinmusicbrigettebrigettebrigettepusheenstevensugarducksofrubberpatricklegerdankholenelsonbolesssojadanielkralljakedrawseranhillanimalsbeingdickstherubdownamandawintersteintonycliffswampghostcartoonfuntimeyannbenedimonstermilkronniedelcarmenollymosseffingdecafjonklassenmarlomeekinsmaikeplenzketheo-guignarddrawthisdressdrawingfriendsdonshankorphanelliottadammutobruno-mangyokusqetchespatakkspacebearcartoonnatelbagelpriscillaworksmidcenturymodernfreakbloch-adrianchristurnhamcosmosontvtomhaugomatwangiesteffromukcatbuirealcatagenteamonnoneillbenjaminmoreauthegreatpromiseproductionjoshparpanlencre-blanchehowieisawesomepeteoswaldtashasquestlog4ambreakfastsbadlyrecreatedanimatedfilmframescityscapesdrawnppostikentosbornelouisthomasartsamsonatworkseokimlikesnotosoftcoredrawnblogdouglasitohenshincyborgseokimdrawsmatthewlyonsdkrall