COOKIE CAAAAAATTT!!!

Here are all of the keys I painted for the Cookie Cat sequence in Gem Glow! I made them as animated GIFs so the overseas studios would know how to treat the moving backgrounds. Check out these really cool early designs for Cookie Cat on Jeff Liu’s Blog! Cookie Cat was masterfully colored by Tiffany Ford who made the brilliant (and delicious) decision to make him two-flavored. I don’t think there has ever been a more delicious prop created for an animated TV show. Cookie Cat’s final design is thanks to Angie Wang! And this sequence was boarded by Joe Johnston.

9,758 notesSERIAL NO. 662893313398 months ago
  1. oddnuisance reblogged this from kevindart
  2. sailor-callisto reblogged this from kevindart
  3. mushroomgorgeous reblogged this from stevencrewniverse
  4. ilikeyoustranger reblogged this from kevindart
  5. pigeonfrompluto reblogged this from kevindart
  6. tofualmondpudding reblogged this from kevindart
  7. le-kennedy reblogged this from kevindart
  8. j4m-ch4n reblogged this from stevencrewniverse
  9. the-solo-deviant reblogged this from psiioniic
  10. zombieswearjordanstoo reblogged this from nolovejustlust
  11. nolovejustlust reblogged this from kevindart
  12. jennymeebo reblogged this from zorobro
  13. zorobro reblogged this from astrejlau
  14. weirdogirlforever reblogged this from wildtaire
  15. wildtaire reblogged this from kevindart
  16. neko-billiejoexx reblogged this from pogoeatnutella
  17. pogoeatnutella reblogged this from stevencrewniverse
  18. mcqueenveins reblogged this from kevindart

Please wait one minute. 




emmanuellewalkermodelarchitecturebeckyandfrankobscurevideogamescrowdedteethturnislefthomejonklassen2junyiwudadushinneo-ramajoeyartscottlavamsmollymbeatonnafemfreqoktotallysketchsharkpaperalligatorcolormathbombsfallrebeccasugaramandawintersteintheimportanceofbeingmodernistsvffstevencrewniversephilnotoerinkkavanaghkikutowneavclubswampghosttoffanyheejinbakestroffietextastrophekingofooothedavidoreillyducksofrubbertheo-guignardyvanduquekiuchitatsuroseventypercentethanolianjqbrigettebrigettebrigettecliobablionatgeofoundjeremieperinalex-rimbaultmattforsythecharleshuettnergunshowcomiceffingdecafprobertsonpusheenkalidrawspenguin-boydrawthisdressemilywalusulan-batorwolfhardtrevorstreasuretrovesbosmavictoriayingellemichalkadrawingfriendslecrcrdonshankpug-of-wardanielkrallalexxgriggeranhillorphanelliottseokimfenrykjakedrawsbabsbabsbabsagredadankholethreewordphrasenedroidcomicsempartridgejeremykupappapamplemousseronniedelcarmenadammutoshinypinkbottlenatazillabruno-mangyokusqetchesanimalsbeingdickspatakkwaltermartinmusicfabien-mensekatiejricespacebearcartoonpatricklegernatelbageldannyhynesguyyanair-dartstefsketchesanimationarchivegreaterthanorequaltocardurrpriscillaworkscartoonretromorenohugojeffturleymidcenturymodernfreaksophiafosterdiminostevensugarnelsonbolesbloch-adrianchristurnhammaikeplenzketombunkertonycliffrebeccamockluisgranecosmosontvtomhaugomatwangietimothylambhjmichelleeastwoodwongcartoonfuntimejonklassensteffromukdarrickbachmancatbuimonstermilkkeepbeachcityweirdrealcatagenteamonnoneillbenjaminmoreauthegreatpromiseproductionjoshparpanmooeollymosslencre-blanchehowieisawesomepeteoswaldtashasquestlog4ambreakfastsmarlomeekinsbadlyrecreatedanimatedfilmframescityscapesdrawnppostikentosbornelouisthomasartsamsonatworkseokimlikesnotosoftcoredrawnblogdouglasitohenshincyborgseokimdrawsmatthewlyonsdkrall