New travel posters! I will have prints available of both of these at Comic Con + t-shirts with the Rio design! Booth 5007!

479 notesSERIAL NO. 925499348101 day ago

Collector’s Space Shuttle Screenprints!

I’ll be debuting 3 new screenprints at Comic Con next week commemorating the amazing Space Shuttle program which spanned 30 years! These will be available indivudually or as a set. Each one is 10”x28”.

Come visit me and my friends Jasmin Lai and Tiffany Ford at Booth #5007!

785 notesSERIAL NO. 919533728501 week ago

COSMOS: A Spacetime Odyssey

Part IV: Drought

4,182 notesSERIAL NO. 865131596302 months ago

COSMOS: A Spacetime Odyssey

Part III: Barbarian Invasion!

2,243 notesSERIAL NO. 864091207702 months ago

COSMOS: A Spacetime Odyssey

Part II: The Gods

One of the really cool things about working on this project was that they were VERY interested in getting all the facts right when it came to historical depictions and they had a dedicated research team that would provide me with all of the most accurate information they could find for every scene in the mini-doc. It was incredibly helpful for illustrating things like the ancient farming techniques, and also for this sequence which featured distinct gods from 6 different civilizations. There was still a little bit of creative interpretation on my end, especially for some of the more obscure gods, but luckily it was close enough and I got the OK from the research team!

1,868 notesSERIAL NO. 863165237702 months ago

COSMOS: A Spacetime Odyssey

Part I: Ancient Mesopotamia

I don’t know how many of you caught this, but I totally had a little segment in last night’s episode of COSMOS, “The Immortals”! It’s about a tremendous drought that destroyed the ancient civilzations of Mesopotamia! FOX approached me about doing this little piece a few months ago and I sprung at the opportunity! If you didn’t know, I am a big fan of SCIENCE and I was so pumped to be a part of this incredible series and to have animated a piece to Neil DeGrasse Tyson’s (my hero!) narration and Ann Druyan’s writing! I am so thankful to Kara Vallow, Brent Woods and Allie Crane for inviting me to take part in this project and being so supportive throughout the production! Also I had an amazing crew to help me create the animation - long-time collaborator Stephane Coedel who was the lead Animator & Compositor, the incredible Stephen Vuillemin who did character animation, and my amazing sister Emily Haidri who produced the spot for us! A real dream job!

Here is a LINK to the full episode if you want to watch (our segment starts around 26:40)!

3,473 notesSERIAL NO. 862276073202 months ago

Mojo Jojo

1,716 notesSERIAL NO. 851341709402 months ago

DOGCOPTER 3 - IN 3D!

Here are some keys I painted for the Dogcopter trailer at the beginning of Lion 2: The Movie, under the direction of the incomparable Elle Michalka!

1,780 notesSERIAL NO. 850267223402 months ago

Hey guys I did a Star Trek poster for Mondo and it’s going on sale today at a random time! I don’t know what time! This is my first poster for Mondo so it’s all an exciting new experience! We’ll see how it goes! I’m told you can follow MondoNews on Twitter to get all the sale info! They are also selling a much cooler poster by Matt Taylor at the same time if you prefer to get that one!

My poster is based on the classic Trek episode “What Are Little Girls Made Of?” which I chose pretty much just because of Sherry Jackson and her amazing duo-tone jumpsuit thing!

537 notesSERIAL NO. 787506733024 months ago

Here are some development posters I painted for the Mr. Peabody & Sherman movie like 3 years ago! I’m not totally sure what these were ever used for but they were really fun to make! You can see them in The Art of Mr. Peabody & Sherman book which is AVAILABLE NOW and has lots of really cool pictures in it!

Oh and the Peabodys in these posters were drawn by Craig Kellman!

3,020 notesSERIAL NO. 786542476404 months ago

Please wait one minute. 




obscurevideogamescrowdedteethturnislefthomejonklassen2junyiwudadushinneo-ramajoeyartscottlavamsmollymbeatonnafemfreqoktotallysketchsharkpaperalligatorcolormathbombsfallrebeccasugaramandawintersteintheimportanceofbeingmodernistsvffstevencrewniversemodelarchitecturephilnotoerinkkavanaghkikutowneavclubswampghosttoffanyheejinbakestroffietextastrophekingofooothedavidoreillyducksofrubbertheo-guignardyvanduquekiuchitatsuroseventypercentethanolianjqbrigettebrigettebrigettecliobablionatgeofoundjeremieperinalex-rimbaultmattforsythebeckyandfrankcharleshuettnergunshowcomiceffingdecafprobertsonpusheenkalidrawspenguin-boydrawthisdressemilywalusulan-batorwolfhardtrevorstreasuretrovesbosmaemmanuellewalkervictoriayingellemichalkadrawingfriendslecrcrdonshankpug-of-wardanielkrallalexxgriggeranhillorphanelliottseokimfenrykjakedrawsbabsbabsbabsagredadankholethreewordphrasenedroidcomicsempartridgejeremykupappapamplemousseronniedelcarmenadammutoshinypinkbottlenatazillabruno-mangyokusqetchesanimalsbeingdickspatakkwaltermartinmusicfabien-mensekatiejricespacebearcartoonpatricklegernatelbageldannyhynesguyyanair-dartstefsketchesanimationarchivegreaterthanorequaltocardurrpriscillaworkscartoonretromorenohugojeffturleymidcenturymodernfreaksophiafosterdiminostevensugarnelsonbolesbloch-adrianchristurnhammaikeplenzketombunkertonycliffrebeccamockluisgranecosmosontvtomhaugomatwangietimothylambhjmichelleeastwoodwongcartoonfuntimejonklassensteffromukdarrickbachmancatbuimonstermilkkeepbeachcityweirdrealcatagenteamonnoneillbenjaminmoreauthegreatpromiseproductionjoshparpanmooeollymosslencre-blanchehowieisawesomepeteoswaldtashasquestlog4ambreakfastsmarlomeekinsbadlyrecreatedanimatedfilmframescityscapesdrawnppostikentosbornelouisthomasartsamsonatworkseokimlikesnotosoftcoredrawnblogdouglasitohenshincyborgseokimdrawsmatthewlyonsdkrall